OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ICAM1 (NM_000201) Human Mass Spec Standard

Be the first to review this product
SKU
PH300714
ICAM1 MS Standard C13 and N15-labeled recombinant protein (NP_000192)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA506870 ICAM1 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4) 100 ul
$447.00
LY400073 Transient overexpression lysate of intercellular adhesion molecule 1 (ICAM1) (as WB positive control) 100 ug
$436.00

Other products for "ICAM1 or NM_000201"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200714
Predicted MW 57.83 kDa
Protein Sequence
Protein Sequence
>RC200714 protein sequence
Red=Cloning site Green=Tags(s)

MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELL
LPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGG
APRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQ
TFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTA
EDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPL
GPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAA
VIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000192
RefSeq Size 2986
RefSeq ORF 1596
Synonyms BB2; CD54; P3.58
Locus ID 3383
UniProt ID P05362
Cytogenetics 19p13.2
Summary This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity, Viral myocarditis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ICAM1" proteins (6)
SKU Description Size Price
LC400073 Lyophilized ICAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400073 Transient overexpression lysate of intercellular adhesion molecule 1 (ICAM1) (as WB positive control) 100 ug
$436.00
TP300714 Purified recombinant protein of Homo sapiens intercellular adhesion molecule 1 (ICAM1), 20 µg 20 ug
$867.00
TP720283 Recombinant protein of human intercellular adhesion molecule 1 (ICAM1) 10 ug
$235.00
TP721375 Recombinant mouse ICAM-1/CD54 protein 10 ug
$245.00
TP723972 Recombinant human ICAM-1 protein with C-terminal mouse Fc tag 100 ug
$825.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products