OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MEA1 (NM_014623) Human Mass Spec Standard

Be the first to review this product
SKU
PH300709
MEA1 MS Standard C13 and N15-labeled recombinant protein (NP_055438)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY415154 Transient overexpression lysate of male-enhanced antigen 1 (MEA1) (as WB positive control) 100 ug
$436.00

Other products for "MEA1 or NM_014623"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200709
Predicted MW 19.9 kDa
Protein Sequence
Protein Sequence
>RC200709 protein sequence
Red=Cloning site Green=Tags(s)

MGPERHLSGAPARMATVVLGGDTMGPERIFPNQTEELGHQGPSEGTGDWSSEEPEEEQEETGSGPAGYSY
QPLNQDPEQEEVELAPVGDGDVVADIQDRIQALGLHLPDPPLESEDEDEEGATALNNHSSIPMDPEHVEL
VKRTMAGVSLPAPGVPAWAREISDAQWEDVVQKALQARQASPAWK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055438
RefSeq Size 868
RefSeq ORF 555
Synonyms HYS; MEA
Locus ID 4201
UniProt ID Q16626
Cytogenetics 6p21.1
Summary May play an important role in spermatogenesis and/or testis development.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MEA1" proteins (3)
SKU Description Size Price
LC415154 Lyophilized MEA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415154 Transient overexpression lysate of male-enhanced antigen 1 (MEA1) (as WB positive control) 100 ug
$436.00
TP300709 Recombinant protein of human male-enhanced antigen 1 (MEA1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products