OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NAGA (NM_000262) Human Mass Spec Standard

Be the first to review this product
SKU
PH300707
NAGA MS Standard C13 and N15-labeled recombinant protein (NP_000253)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811320 NAGA mouse monoclonal antibody,clone OTI3A4 100 ul
$447.00
LY400100 Transient overexpression lysate of N-acetylgalactosaminidase, alpha- (NAGA) (as WB positive control) 100 ug
$436.00

Other products for "NAGA or NM_000262"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200707
Predicted MW 46.6 kDa
Protein Sequence
Protein Sequence
>RC200707 protein sequence
Red=Cloning site Green=Tags(s)

MLLKTVLLLGHVAQVLMLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDM
GYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQ
DAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLADICN
LWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPL
LMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYR
YHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000253
RefSeq Size 3726
RefSeq ORF 1233
Synonyms D22S674; GALB
Locus ID 4668
UniProt ID P17050
Cytogenetics 22q13.2
Summary NAGA encodes the lysosomal enzyme alpha-N-acetylgalactosaminidase, which cleaves alpha-N-acetylgalactosaminyl moieties from glycoconjugates. Mutations in NAGA have been identified as the cause of Schindler disease types I and II (type II also known as Kanzaki disease). provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Glycosphingolipid biosynthesis - globo series, Lysosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NAGA" proteins (3)
SKU Description Size Price
LC400100 Lyophilized NAGA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400100 Transient overexpression lysate of N-acetylgalactosaminidase, alpha- (NAGA) (as WB positive control) 100 ug
$436.00
TP300707 Recombinant protein of human N-acetylgalactosaminidase, alpha- (NAGA), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products