OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SERPINB6 (NM_004568) Human Mass Spec Standard

Be the first to review this product
SKU
PH300668
SERPINB6 MS Standard C13 and N15-labeled recombinant protein (NP_004559)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504127 SERPINB6 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5) 100 ul
$447.00
LY417897 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 6 (SERPINB6) (as WB positive control) 100 ug
$436.00

Other products for "SERPINB6 or NM_004568"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200668
Predicted MW 42.4 kDa
Protein Sequence
Protein Sequence
>RC200668 representing NM_004568
Red=Cloning site Green=Tags(s)

MDVLAEANGTFALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQ
GFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAE
KTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTY
IGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESY
DMESVLRNLGMTDAFELGKADFSGMSQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVPRFC
ADHPFLFFIQHSKTNGILFCGRFSSP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004559
RefSeq Size 1665
RefSeq ORF 1128
Synonyms CAP; DFNB91; MSTP057; PI-6; PI6; PTI; SPI3
Locus ID 5269
UniProt ID P35237
Cytogenetics 6p25.2
Summary The protein encoded by this gene is a member of the serpin (serine proteinase inhibitor) superfamily, and ovalbumin(ov)-serpin subfamily. It was originally discovered as a placental thrombin inhibitor. The mouse homolog was found to be expressed in the hair cells of the inner ear. Mutations in this gene are associated with nonsyndromic progressive hearing loss, suggesting that this serpin plays an important role in the inner ear in the protection against leakage of lysosomal content during stress, and that loss of this protection results in cell death and sensorineural hearing loss. Alternatively spliced transcript variants have been found for this gene. provided by RefSeq, Sep 2010
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SERPINB6" proteins (4)
SKU Description Size Price
LC417897 Lyophilized SERPINB6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417897 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 6 (SERPINB6) (as WB positive control) 100 ug
$436.00
TP300668 Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 6 (SERPINB6), 20 µg 20 ug
$867.00
TP720554 Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 6 (SERPINB6) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products