OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SERPINB9 (NM_004155) Human Mass Spec Standard

Be the first to review this product
SKU
PH300645
SERPINB9 MS Standard C13 and N15-labeled recombinant protein (NP_004146)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA312970 Rabbit polyclonal anti-SERPINB9 antibody
100 ul
$380.00
LY418182 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 9 (SERPINB9) (as WB positive control) 100 ug
$436.00

Other products for "SERPINB9 or NM_004155"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200645
Predicted MW 42.4 kDa
Protein Sequence
Protein Sequence
>RC200645 protein sequence
Red=Cloning site Green=Tags(s)

METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAF
QSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKT
EGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVG
EVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDM
ESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFC
ADHPFLFFIRHNRANSILFCGRFSSP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004146
RefSeq Size 4167
RefSeq ORF 1128
Synonyms CAP-3; CAP3; PI-9; PI9
Locus ID 5272
UniProt ID P50453
Cytogenetics 6p25.2
Summary This gene encodes a member of the serine protease inhibitor family which are also known as serpins. The encoded protein belongs to a subfamily of intracellular serpins. This protein inhibits the activity of the effector molecule granzyme B. Overexpression of this protein may prevent cytotoxic T-lymphocytes from eliminating certain tumor cells. A pseudogene of this gene is found on chromosome 6. provided by RefSeq, Mar 2012
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SERPINB9" proteins (3)
SKU Description Size Price
LC418182 Lyophilized SERPINB9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418182 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 9 (SERPINB9) (as WB positive control) 100 ug
$436.00
TP300645 Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 9 (SERPINB9), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products