OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRAPPC3 (NM_014408) Human Mass Spec Standard

Be the first to review this product
SKU
PH300602
TRAPPC3 MS Standard C13 and N15-labeled recombinant protein (NP_055223)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA315364 Rabbit polyclonal anti-TRAPPC3 antibody
100 ul
$380.00
LY415301 Transient overexpression lysate of trafficking protein particle complex 3 (TRAPPC3) (as WB positive control) 100 ug
$436.00

Other products for "TRAPPC3 or NM_014408"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200602
Predicted MW 20.3 kDa
Protein Sequence
Protein Sequence
>RC200602 protein sequence
Red=Cloning site Green=Tags(s)

MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHD
FRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALE
MVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055223
RefSeq Size 1333
RefSeq ORF 540
Synonyms BET3
Locus ID 27095
UniProt ID O43617
Cytogenetics 1p34.3
Summary This gene encodes a component of the trafficking protein particle complex, which tethers transport vesicles to the cis-Golgi membrane. The encoded protein participates in the regulation of transport from the endoplasmic reticulum to the Golgi apparatus. Alternative splicing results in multiple transcript variants. provided by RefSeq, Aug 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TRAPPC3" proteins (3)
SKU Description Size Price
LC415301 Lyophilized TRAPPC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415301 Transient overexpression lysate of trafficking protein particle complex 3 (TRAPPC3) (as WB positive control) 100 ug
$436.00
TP300602 Recombinant protein of human trafficking protein particle complex 3 (TRAPPC3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products