OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PFDN1 (NM_002622) Human Mass Spec Standard

Be the first to review this product
SKU
PH300584
PFDN1 MS Standard C13 and N15-labeled recombinant protein (NP_002613)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA366718 PFDN1 rabbit polyclonal antibody
100 ul
$310.00
LY419197 Transient overexpression lysate of prefoldin subunit 1 (PFDN1) (as WB positive control) 100 ug
$436.00

Other products for "PFDN1 or NM_002622"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200584
Predicted MW 14.2 kDa
Protein Sequence
Protein Sequence
>RC200584 protein sequence
Red=Cloning site Green=Tags(s)

MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFIL
QSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002613
RefSeq Size 1324
RefSeq ORF 366
Synonyms PDF; PFD1
Locus ID 5201
UniProt ID O60925
Cytogenetics 5q31.3
Summary This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. provided by RefSeq, Jul 2008
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PFDN1" proteins (3)
SKU Description Size Price
LC419197 Lyophilized PFDN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419197 Transient overexpression lysate of prefoldin subunit 1 (PFDN1) (as WB positive control) 100 ug
$436.00
TP300584 Recombinant protein of human prefoldin subunit 1 (PFDN1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products