OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GNG5 (NM_005274) Human Mass Spec Standard

Be the first to review this product
SKU
PH300572
GNG5 MS Standard C13 and N15-labeled recombinant protein (NP_005265)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA313935 Rabbit polyclonal anti-GNG5 antibody
100 ul
$380.00
LY417407 Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 5 (GNG5) (as WB positive control) 100 ug
$436.00

Other products for "GNG5 or NM_005274"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200572
Predicted MW 7.3 kDa
Protein Sequence
Protein Sequence
>RC200572 protein sequence
Red=Cloning site Green=Tags(s)

MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005265
RefSeq Size 823
RefSeq ORF 204
Locus ID 2787
UniProt ID P63218
Cytogenetics 1p22.3
Summary G proteins are trimeric (alpha-beta-gamma) membrane-associated proteins that regulate flow of information from cell surface receptors to a variety of internal metabolic effectors. Interaction of a G protein with its activated receptor promotes exchange of GTP for GDP that is bound to the alpha subunit. The alpha-GTP complex dissociates from the beta-gamma heterodimer so that the subunits, in turn, may interact with and regulate effector molecules (Gilman, 1987 PubMed 3113327; summary by Ahmad et al., 1995) PubMed 7606925.supplied by OMIM, Nov 2010
Protein Pathways Chemokine signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GNG5" proteins (3)
SKU Description Size Price
LC417407 Lyophilized GNG5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417407 Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 5 (GNG5) (as WB positive control) 100 ug
$436.00
TP300572 Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 5 (GNG5), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products