OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NDUFA7 (NM_005001) Human Mass Spec Standard

Be the first to review this product
SKU
PH300534
NDUFA7 MS Standard C13 and N15-labeled recombinant protein (NP_004992)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502658 NDUFA7 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4) 100 ul
$447.00
LY417603 Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa (NDUFA7) (as WB positive control) 100 ug
$436.00

Other products for "NDUFA7 or NM_005001"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200534
Predicted MW 12.6 kDa
Protein Sequence
Protein Sequence
>RC200534 protein sequence
Red=Cloning site Green=Tags(s)

MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRRESVPPSIIM
SSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004992
RefSeq Size 585
RefSeq ORF 339
Synonyms B14.5a; CI-B14.5a
Locus ID 4701
UniProt ID O95182
Cytogenetics 19p13.2
Summary This gene encodes a subunit of NADH:ubiquinone oxidoreductase (complex I), which is a multiprotein complex located in the inner mitochondrial membrane. Complex I functions in the transfer of electrons from NADH to the respiratory chain. provided by RefSeq, Mar 2011
Protein Pathways Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NDUFA7" proteins (3)
SKU Description Size Price
LC417603 Lyophilized NDUFA7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417603 Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa (NDUFA7) (as WB positive control) 100 ug
$436.00
TP300534 Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa (NDUFA7), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products