OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AKR1B1 (NM_001628) Human Mass Spec Standard

Be the first to review this product
SKU
PH300504
AKR1B1 MS Standard C13 and N15-labeled recombinant protein (NP_001619)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA323141 Anti-AKR1B1 Rabbit Polyclonal Antibody
100 ul
$305.00
LY419838 Transient overexpression lysate of aldo-keto reductase family 1, member B1 (aldose reductase) (AKR1B1) (as WB positive control) 100 ug
$436.00

Other products for "AKR1B1 or NM_001628"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200504
Predicted MW 35.7 kDa
Protein Sequence
Protein Sequence
>RC200504 representing NM_001628
Red=Cloning site Green=Tags(s)

MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
EELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILD
TWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAY
SPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFE
LSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001619
RefSeq Size 1416
RefSeq ORF 948
Synonyms ADR; ALDR1; ALR2; AR
Locus ID 231
UniProt ID P15121
Cytogenetics 7q33
Summary This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. provided by RefSeq, Feb 2009
Protein Families Druggable Genome
Protein Pathways Fructose and mannose metabolism, Galactose metabolism, Glycerolipid metabolism, Metabolic pathways, Pentose and glucuronate interconversions, Pyruvate metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AKR1B1" proteins (3)
SKU Description Size Price
LC419838 Lyophilized AKR1B1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419838 Transient overexpression lysate of aldo-keto reductase family 1, member B1 (aldose reductase) (AKR1B1) (as WB positive control) 100 ug
$436.00
TP300504 Purified recombinant protein of Homo sapiens aldo-keto reductase family 1, member B1 (aldose reductase) (AKR1B1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products