OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD52 (NM_001803) Human Mass Spec Standard

Be the first to review this product
SKU
PH300493
CD52 MS Standard C13 and N15-labeled recombinant protein (NP_001794)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA385689 anti-Human CD52 Monoclonal Antibody (Alemtuzumab Biosimilar)
200 ug
$770.00
LY419739 Transient overexpression lysate of CD52 molecule (CD52) (as WB positive control) 100 ug
$436.00

Other products for "CD52 or NM_001803"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200493
Predicted MW 6.6 kDa
Protein Sequence
Protein Sequence
>RC200493 protein sequence
Red=Cloning site Green=Tags(s)

MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSSMSGGIFLFFVANAIIHLFCFS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001794
RefSeq Size 523
RefSeq ORF 183
Synonyms CDW52; EDDM5; HE5
Locus ID 1043
UniProt ID P31358
Cytogenetics 1p36.11
Summary May play a role in carrying and orienting carbohydrate, as well as having a more specific role.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD52" proteins (3)
SKU Description Size Price
LC419739 Lyophilized CD52 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419739 Transient overexpression lysate of CD52 molecule (CD52) (as WB positive control) 100 ug
$436.00
TP300493 Recombinant protein of human CD52 molecule (CD52), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products