OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CKS2 (NM_001827) Human Mass Spec Standard

Be the first to review this product
SKU
PH300491
CKS2 MS Standard C13 and N15-labeled recombinant protein (NP_001818)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308257 Rabbit polyclonal antibody to CKS-2 (CDC28 protein kinase regulatory subunit 2)
100 ul
$665.00
LY419728 Transient overexpression lysate of CDC28 protein kinase regulatory subunit 2 (CKS2) (as WB positive control) 100 ug
$436.00

Other products for "CKS2 or NM_001827"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200491
Predicted MW 9.9 kDa
Protein Sequence
Protein Sequence
>RC200491 protein sequence
Red=Cloning site Green=Tags(s)

MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFR
RPLPKDQQK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001818
RefSeq Size 627
RefSeq ORF 237
Synonyms CKSHS2
Locus ID 1164
UniProt ID P33552
Cytogenetics 9q22.2
Summary CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Stem cell - Pluripotency
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CKS2" proteins (3)
SKU Description Size Price
LC419728 Lyophilized CKS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419728 Transient overexpression lysate of CDC28 protein kinase regulatory subunit 2 (CKS2) (as WB positive control) 100 ug
$436.00
TP300491 Recombinant protein of human CDC28 protein kinase regulatory subunit 2 (CKS2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products