OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BNIP2 (NM_004330) Human Mass Spec Standard

Be the first to review this product
SKU
PH300377
BNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_004321)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA806500 BNIP2 mouse monoclonal antibody, clone OTI1C12 (formerly 1C12) 100 ul
$447.00
LY401378 Transient overexpression lysate of BCL2/adenovirus E1B 19kDa interacting protein 2 (BNIP2) (as WB positive control) 100 ug
$665.00

Other products for "BNIP2 or NM_004330"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200377
Predicted MW 36 kDa
Protein Sequence
Protein Sequence
>RC200377 protein sequence
Red=Cloning site Green=Tags(s)

MEGVELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVL
SDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDH
RVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVY
LNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAE
LAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004321
RefSeq Size 2533
RefSeq ORF 942
Synonyms BNIP-2; NIP2
Locus ID 663
UniProt ID Q12982
Cytogenetics 15q22.2
Summary This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. Alternate splicing results in multiple transcript variants. provided by RefSeq, Mar 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BNIP2" proteins (3)
SKU Description Size Price
LC401378 Lyophilized BNIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401378 Transient overexpression lysate of BCL2/adenovirus E1B 19kDa interacting protein 2 (BNIP2) (as WB positive control) 100 ug
$665.00
TP300377 Recombinant protein of human BCL2/adenovirus E1B 19kDa interacting protein 2 (BNIP2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products