BNIP2 (NM_004330) Human Mass Spec Standard

CAT#: PH300377

BNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_004321)

Product Images

Coomassie blue staining of purified BNIP2 protein (Cat# TP300377). The protein was produced from HEK293T cells transfected with BNIP2 cDNA clone (Cat# RC200377) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200377
• Predicted MW: 36 kDa
• Protein Sequence:
  Sequence Link

  >RC200377 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEGVELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVL
  SDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDH
  RVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVY
  LNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAE
  LAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004321
• RefSeq Size: 2533
• RefSeq ORF: 942
• Synonyms: BNIP-2; NIP2
• Locus ID: 663
• UniProt ID: Q12982, J3KN59
• Cytogenetics: 15q22.2
• Summary: This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]