CDK5 (NM_004935) Human Mass Spec Standard

SKU
PH300342
CDK5 MS Standard C13 and N15-labeled recombinant protein (NP_004926)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200342]
Predicted MW 33.3 kDa
Protein Sequence
Protein Sequence
>RC200342 protein sequence
Red=Cloning site Green=Tags(s)

MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVL
HSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGEL
KLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDD
QLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEA
LQHPYFSDFCPP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004926
RefSeq Size 1211
RefSeq ORF 876
Synonyms LIS7; PSSALRE
Locus ID 1020
UniProt ID Q00535
Cytogenetics 7q36.1
Summary This gene encodes a proline-directed serine/threonine kinase that is a member of the cyclin-dependent kinase family of proteins. Unlike other members of the family, the protein encoded by this gene does not directly control cell cycle regulation. Instead the protein, which is predominantly expressed at high levels in mammalian postmitotic central nervous system neurons, functions in diverse processes such as synaptic plasticity and neuronal migration through phosphorylation of proteins required for cytoskeletal organization, endocytosis and exocytosis, and apoptosis. In humans, an allelic variant of the gene that results in undetectable levels of the protein has been associated with lethal autosomal recessive lissencephaly-7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Alzheimer's disease, Axon guidance
Write Your Own Review
You're reviewing:CDK5 (NM_004935) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401536 CDK5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431225 CDK5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401536 Transient overexpression lysate of cyclin-dependent kinase 5 (CDK5), transcript variant 1 100 ug
$436.00
LY431225 Transient overexpression lysate of cyclin-dependent kinase 5 (CDK5), transcript variant 2 100 ug
$436.00
TP300342 Recombinant protein of human cyclin-dependent kinase 5 (CDK5), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.