OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

USP14 (NM_005151) Human Mass Spec Standard

Be the first to review this product
SKU
PH300337
USP14 MS Standard C13 and N15-labeled recombinant protein (NP_005142)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA324906 USP14 Antibody (N-term)
400 ul
$645.00
LY417492 Transient overexpression lysate of ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) (USP14), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "USP14 or NM_005151"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200337
Predicted MW 56.1 kDa
Protein Sequence
Protein Sequence
>RC200337 protein sequence
Red=Cloning site Green=Tags(s)

MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLL
MMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGAL
RASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRV
LQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFIN
QEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFP
LMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDL
QAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEE
ESEQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005142
RefSeq Size 4156
RefSeq ORF 1482
Synonyms TGT
Locus ID 9097
UniProt ID P54578
Cytogenetics 18p11.32
Summary This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "USP14" proteins (4)
SKU Description Size Price
LC417492 Lyophilized USP14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417492 Transient overexpression lysate of ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) (USP14), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP300337 Recombinant protein of human ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) (USP14), transcript variant 1, 20 µg 20 ug
$867.00
TP720168 Recombinant protein of human ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) (USP14), transcript variant 2 10 ug
$220.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products