OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Angiopoietin like 7 (ANGPTL7) (NM_021146) Human Mass Spec Standard

Be the first to review this product
SKU
PH300321
ANGPTL7 MS Standard C13 and N15-labeled recombinant protein (NP_066969)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA364595 ANGPTL7 rabbit polyclonal antibody
100 ul
$310.00
LY402846 Transient overexpression lysate of angiopoietin-like 7 (ANGPTL7) (as WB positive control) 100 ug
$436.00

Other products for "Angiopoietin like 7 or NM_021146"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200321
Predicted MW 40 kDa
Protein Sequence
Protein Sequence
>RC200321 protein sequence
Red=Cloning site Green=Tags(s)

MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQ
ERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYR
ISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIH
RLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDN
CLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066969
RefSeq Size 2307
RefSeq ORF 1038
Synonyms AngX; CDT6; dJ647M16.1
Locus ID 10218
UniProt ID O43827
Cytogenetics 1p36.22
Summary Has a role in the formation and organization of the extracellular matrix. In the eye, it functions as a mediator of dexamethasone-induced matrix deposition in the trabecular meshwork, the tissue responsible for the outflow of the ocular aqueous humor and for the maintenance of intraocular pressure (PubMed:21199193). Is a negative regulator of angiogenesis in the cornea, and plays a major role in maintaining corneal avascularity and transparency (PubMed:25622036).UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Angiopoietin like 7" proteins (3)
SKU Description Size Price
LC402846 Lyophilized ANGPTL7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402846 Transient overexpression lysate of angiopoietin-like 7 (ANGPTL7) (as WB positive control) 100 ug
$436.00
TP300321 Recombinant protein of human angiopoietin-like 7 (ANGPTL7), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products