OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LSM1 (NM_014462) Human Mass Spec Standard

Be the first to review this product
SKU
PH300288
LSM1 MS Standard C13 and N15-labeled recombinant protein (NP_055277)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503120 LSM1 mouse monoclonal antibody, clone OTI5C6 (formerly 5C6) 100 ul
$447.00
LY415265 Transient overexpression lysate of LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1) (as WB positive control) 100 ug
$436.00

Other products for "LSM1 or NM_014462"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200288
Predicted MW 15.2 kDa
Protein Sequence
Protein Sequence
>RC200288 protein sequence
Red=Cloning site Green=Tags(s)

MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGEN
VVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055277
RefSeq Size 1161
RefSeq ORF 399
Synonyms CASM; YJL124C
Locus ID 27257
UniProt ID O15116
Cytogenetics 8p11.23
Summary This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Increased expression of this gene may play a role in cellular transformation and the progression of several malignancies including lung cancer, mesothelioma and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. provided by RefSeq, Nov 2011
Protein Families Stem cell - Pluripotency
Protein Pathways RNA degradation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LSM1" proteins (4)
SKU Description Size Price
LC415265 Lyophilized LSM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415265 Transient overexpression lysate of LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1) (as WB positive control) 100 ug
$436.00
TP300288 Recombinant protein of human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1), 20 µg 20 ug
$867.00
TP720235 Recombinant protein of human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products