OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMEM14B (NM_030969) Human Mass Spec Standard

Be the first to review this product
SKU
PH300239
TMEM14B MS Standard C13 and N15-labeled recombinant protein (NP_112231)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY410633 Transient overexpression lysate of transmembrane protein 14B (TMEM14B), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "TMEM14B or NM_030969"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200239
Predicted MW 12.2 kDa
Protein Sequence
Protein Sequence
>RC200239 protein sequence
Red=Cloning site Green=Tags(s)

MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAWLLFGSLAGLGAYQLYQDPRNVWGFLAAT
SVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112231
RefSeq Size 992
RefSeq ORF 342
Locus ID 81853
UniProt ID Q9NUH8
Cytogenetics 6p24.2
Summary Primate-specific protein involved in cortical expansion and folding in the developing neocortex. May drive neural progenitor proliferation through nuclear translocation of IQGAP1, which in turn promotes G1/S cell cycle transitions.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMEM14B" proteins (3)
SKU Description Size Price
LC410633 Lyophilized TMEM14B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410633 Transient overexpression lysate of transmembrane protein 14B (TMEM14B), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP300239 Recombinant protein of human transmembrane protein 14B (TMEM14B), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products