OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VSIG2 (NM_014312) Human Mass Spec Standard

Be the first to review this product
SKU
PH300170
VSIG2 MS Standard C13 and N15-labeled recombinant protein (NP_055127)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502125 VSIG2 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8) 100 ul
$447.00
LY415368 Transient overexpression lysate of V-set and immunoglobulin domain containing 2 (VSIG2) (as WB positive control) 100 ug
$436.00

Other products for "VSIG2 or NM_014312"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200170
Predicted MW 34.3 kDa
Protein Sequence
Protein Sequence
>RC200170 protein sequence
Red=Cloning site Green=Tags(s)

MAELPGPFLCGALLGFLCLSGLAVEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISE
SHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLT
VLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLT
SSGTYRCVATNQMGSASCELTLSVTEPSQGRVAGALIGVLLGVLLLSVAAFCLVRFQKERGKKPKETYGG
SDLREDAIAPGISEHTCMRADSSKGFLERPSSASTVTTTKSKLPMVV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055127
RefSeq Size 1138
RefSeq ORF 981
Synonyms 2210413P10Rik; CTH; CTXL
Locus ID 23584
UniProt ID Q96IQ7
Cytogenetics 11q24.2
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VSIG2" proteins (4)
SKU Description Size Price
LC415368 Lyophilized VSIG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415368 Transient overexpression lysate of V-set and immunoglobulin domain containing 2 (VSIG2) (as WB positive control) 100 ug
$436.00
TP300170 Recombinant protein of human V-set and immunoglobulin domain containing 2 (VSIG2), 20 µg 20 ug
$867.00
TP720453 Recombinant protein of human V-set and immunoglobulin domain containing 2 (VSIG2) 10 ug
$235.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products