OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CFAP298 (NM_021254) Human Mass Spec Standard

Be the first to review this product
SKU
PH300169
C21orf59 MS Standard C13 and N15-labeled recombinant protein (NP_067077)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501350 C21orf59 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5) 100 ul
$447.00
LY402864 Transient overexpression lysate of chromosome 21 open reading frame 59 (C21orf59) (as WB positive control) 100 ug
$436.00

Other products for "CFAP298 or NM_021254"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200169
Predicted MW 33.2 kDa
Protein Sequence
Protein Sequence
>RC200169 protein sequence
Red=Cloning site Green=Tags(s)

MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQI
EELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVK
DALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGK
NEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFH
GVKDIKWRPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067077
RefSeq Size 1427
RefSeq ORF 870
Synonyms C21orf48; C21orf59; CILD26; FBB18; Kur
Locus ID 56683
UniProt ID P57076
Cytogenetics 21q22.11
Summary This gene encodes a protein that plays a critical role in dynein arm assembly and motile cilia function. Mutations in this gene result in primary ciliary dyskinesia. Naturally occuring readthrough transcription occurs from this locus to the downstream t-complex 10 like (TCP10L) gene. provided by RefSeq, Apr 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CFAP298" proteins (3)
SKU Description Size Price
LC402864 Lyophilized C21orf59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402864 Transient overexpression lysate of chromosome 21 open reading frame 59 (C21orf59) (as WB positive control) 100 ug
$436.00
TP300169 Recombinant protein of human chromosome 21 open reading frame 59 (C21orf59), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products