OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZNF692 (NM_017865) Human Mass Spec Standard

Be the first to review this product
SKU
PH300163
ZNF692 MS Standard C13 and N15-labeled recombinant protein (NP_060335)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331880 Rabbit Polyclonal Anti-ZNF692 Antibody
100 ul
$585.00
LY434257 Transient overexpression lysate of zinc finger protein 692 (ZNF692), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "ZNF692 or NM_017865"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200163
Predicted MW 57 kDa
Protein Sequence
Protein Sequence
>RC200163 protein sequence
Red=Cloning site Green=Tags(s)

MASSPAVDVSCRRREKRRQLDARRSKCRIRLGGHMEQWCLLKERLGFSLHSQLAKFLLDRYTSSGCVLCA
GPEPLPPKGLQYLVLLSHAHSRECSLVPGLRGPGGQDGGLVWECSAGHTFSWGPSLSPTPSEAPKPASLP
HTTRRSWCSEATSGQELADLESEHDERTQEARLPRRVGPPPETFPPPGEEEGEEEEDNDEDEEEMLSDAS
LWTYSSSPDDSEPDAPRLLPSPVTCTPKEGETPPAPAALSSPLAVPALSASSLSSRAPPPAEVRVQPQLS
RTPQAAQQTEALASTGSQAQSAPTPAWDEDTAQIGPKRIRKAAKRELMPCDFPGCGRIFSNRQYLNHHKK
YQHIHQKSFSCPEPACGKSFNFKKHLKEHMKLHSDTRDYICEFCARSFRTSSNLVIHRRIHTGEKPLQCE
ICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESPSGPLEPCP
SISAPGPLGSSEGSRPSASPQAPTLLPQQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060335
RefSeq Size 1992
RefSeq ORF 1557
Synonyms AREBP; Zfp692
Locus ID 55657
UniProt ID Q9BU19
Cytogenetics 1q44
Summary May be involved in transcriptional regulation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ZNF692" proteins (5)
SKU Description Size Price
LC413487 Lyophilized ZNF692 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434257 Lyophilized ZNF692 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413487 Transient overexpression lysate of zinc finger protein 692 (ZNF692), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY434257 Transient overexpression lysate of zinc finger protein 692 (ZNF692), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP300163 Recombinant protein of human zinc finger protein 692 (ZNF692), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products