OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WDR5 (NM_052821) Human Mass Spec Standard

Be the first to review this product
SKU
PH300162
WDR5 MS Standard C13 and N15-labeled recombinant protein (NP_438172)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350617 Rabbit Polyclonal Anti-WDR5 Antibody
100 ul
$205.00
LY409441 Transient overexpression lysate of WD repeat domain 5 (WDR5), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "WDR5 or NM_052821"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200162
Predicted MW 36.6 kDa
Protein Sequence
Protein Sequence
>RC200162 protein sequence
Red=Cloning site Green=Tags(s)

MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIK
IWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ
SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLI
DDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSED
NLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_438172
RefSeq Size 3078
RefSeq ORF 1002
Synonyms BIG-3; CFAP89; SWD3
Locus ID 11091
UniProt ID P61964
Cytogenetics 9q34.2
Summary This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "WDR5" proteins (7)
SKU Description Size Price
PH316218 WDR5 MS Standard C13 and N15-labeled recombinant protein (NP_060058) 10 ug
$3,360.00
LC402599 Lyophilized WDR5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409441 Lyophilized WDR5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402599 Transient overexpression lysate of WD repeat domain 5 (WDR5), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY409441 Transient overexpression lysate of WD repeat domain 5 (WDR5), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300162 Recombinant protein of human WD repeat domain 5 (WDR5), transcript variant 2, 20 µg 20 ug
$737.00
TP316218 Recombinant protein of human WD repeat domain 5 (WDR5), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products