OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ANKZF1 (NM_001042410) Human Mass Spec Standard

Be the first to review this product
SKU
PH300140
ANKZF1 MS Standard C13 and N15-labeled recombinant protein (NP_001035869)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA366893 ANKZF1 rabbit polyclonal antibody
100 ul
$310.00
LY413331 Transient overexpression lysate of ankyrin repeat and zinc finger domain containing 1 (ANKZF1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "ANKZF1 or NM_001042410"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200140
Predicted MW 80.9 kDa
Protein Sequence
Protein Sequence
>RC200140 protein sequence
Red=Cloning site Green=Tags(s)

MSPAPDAAPAPASISLFDLSADAPVFQGLSLVSHAPGEALARAPRTSCSGSGERESPERKLLQGPMDISE
KLFCSTCDQTFQNHQEQREHYKLDWHRFNLKQRLKDKPLLSALDFEKQSSTGDLSSISGSEDSDSASEED
LQTLDRERATFEKLSRPPGFYPHRVLFQNAQGQFLYAYRCVLGPHQDPPEEAELLLQNLQSRGPRDCVVL
MAAAGHFAGAIFQGREVVTHKTFHRYTVRAKRGTAQGLRDARGGPSHSAGANLRRYNEATLYKDVRDLLA
GPSWAKALEEAGTILLRAPRSGRSLFFGGKGAPLQRGDPRLWDIPLATRRPTFQELQRVLHKLTTLHVYE
EDPREAVRLHSPQTHWKTVREERKKPTEEEIRKICRDEKEALGQNEESPKQGSGSEGEDGFQVELELVEL
TVGTLDLCESEVLPKRRRRKRNKKEKSRDQEAGAHRTLLQQTQEEEPSTQSSQAVAAPLGPLLDEAKAPG
QPELWNALLAACRAGDVGVLKLQLAPSPADPRVLSLLSAPLGSGGFTLLHAAAAAGRGSVVRLLLEAGAD
PTVQDSRARPPYTVAADKSTRNEFRRFMEKNPDAYDYNKAQVPGPLTPEMEARQATRKREQKAARRQREE
QQQRQQEQEEREREEQRRFAALSDREKRALAAERRLAAQLGAPTSPIPDSAIVNTRRCWSCGASLQGLTP
FHYLDFSFCSTRCLQDHRRQAGRPSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035869
RefSeq Size 2521
RefSeq ORF 2178
Synonyms Vms1; ZNF744
Locus ID 55139
UniProt ID Q9H8Y5
Cytogenetics 2q35
Summary Plays a role in the cellular response to hydrogen peroxide and in the maintenance of mitochondrial integrity under conditions of cellular stress (PubMed:28302725). Involved in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ANKZF1" proteins (7)
SKU Description Size Price
PH301054 ANKZF1 MS Standard C13 and N15-labeled recombinant protein (NP_060559) 10 ug
$3,360.00
LC413331 Lyophilized ANKZF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420885 Lyophilized ANKZF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413331 Transient overexpression lysate of ankyrin repeat and zinc finger domain containing 1 (ANKZF1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420885 Transient overexpression lysate of ankyrin repeat and zinc finger domain containing 1 (ANKZF1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300140 Recombinant protein of human ankyrin repeat and zinc finger domain containing 1 (ANKZF1), transcript variant 2, 20 µg 20 ug
$737.00
TP301054 Recombinant protein of human ankyrin repeat and zinc finger domain containing 1 (ANKZF1), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products