OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PNPO (NM_018129) Human Mass Spec Standard

Be the first to review this product
SKU
PH300133
PNPO MS Standard C13 and N15-labeled recombinant protein (NP_060599)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503506 PNPO mouse monoclonal antibody, clone OTI1G9 (formerly 1G9) 100 ul
$447.00
LY413282 Transient overexpression lysate of pyridoxamine 5'-phosphate oxidase (PNPO) (as WB positive control) 100 ug
$436.00

Other products for "PNPO or NM_018129"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200133
Predicted MW 30 kDa
Protein Sequence
Protein Sequence
>RC200133 protein sequence
Red=Cloning site Green=Tags(s)

MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAV
QCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEPLNRQV
RVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYV
LYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060599
RefSeq Size 3482
RefSeq ORF 783
Synonyms HEL-S-302; PDXPO
Locus ID 55163
UniProt ID Q9NVS9
Cytogenetics 17q21.32
Summary The enzyme encoded by this gene catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine. Mutations in this gene result in pyridoxamine 5'-phosphate oxidase (PNPO) deficiency, a form of neonatal epileptic encephalopathy. provided by RefSeq, Oct 2008
Protein Pathways Metabolic pathways, Vitamin B6 metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PNPO" proteins (3)
SKU Description Size Price
LC413282 Lyophilized PNPO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413282 Transient overexpression lysate of pyridoxamine 5'-phosphate oxidase (PNPO) (as WB positive control) 100 ug
$436.00
TP300133 Recombinant protein of human pyridoxamine 5'-phosphate oxidase (PNPO), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products