OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NTAL (LAT2) (NM_032463) Human Mass Spec Standard

Be the first to review this product
SKU
PH300102
LAT2 MS Standard C13 and N15-labeled recombinant protein (NP_115852)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA322392 Anti-LAT2 Rabbit Polyclonal Antibody
100 ul
$305.00
LY410097 Transient overexpression lysate of linker for activation of T cells family, member 2 (LAT2), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "NTAL or NM_032463"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200102
Predicted MW 26.6 kDa
Protein Sequence
Protein Sequence
>RC200102 protein sequence
Red=Cloning site Green=Tags(s)

MSSGTELLWPGAALLVLLGVAASLCVRCSRPGAKRSEKIYQQRSLREDQQSFTGSRTYSLVGQAWPGPLA
DMAPTRKDKLLQFYPSLEDPASSRYQNFSKGSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVL
ICKQKTTETGAQQEGIGGLCRGDLSLSLALKTGPTSGLCPSASPEEDEESEDYQNSASIHQWRESRKVMG
QLQREASPGPVGSPDEEDGEPDYVNGEVAATEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115852
RefSeq Size 2129
RefSeq ORF 729
Synonyms HSPC046; LAB; NTAL; WBSCR5; WBSCR15; WSCR5
Locus ID 7462
UniProt ID Q9GZY6
Cytogenetics 7q11.23
Summary This gene is one of the contiguous genes at 7q11.23 commonly deleted in Williams syndrome, a multisystem developmental disorder. This gene consists of at least 14 exons, and its alternative splicing generates 3 transcript variants, all encoding the same protein. provided by RefSeq, Jul 2008
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NTAL" proteins (7)
SKU Description Size Price
LC410097 Lyophilized LAT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC410098 Lyophilized LAT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415475 Lyophilized LAT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410097 Transient overexpression lysate of linker for activation of T cells family, member 2 (LAT2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY410098 Transient overexpression lysate of linker for activation of T cells family, member 2 (LAT2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY415475 Transient overexpression lysate of linker for activation of T cells family, member 2 (LAT2), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP300102 Recombinant protein of human linker for activation of T cells family, member 2 (LAT2), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products