COX16 (NM_016468) Human Mass Spec Standard

SKU PH300099

COX16 MS Standard C13 and N15-labeled recombinant protein (NP_057552)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200099]
• Predicted MW: 12.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC200099 protein sequence; Red=Cloning site Green=Tags(s); ; MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKI; KDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_057552
• RefSeq Size: 1724
• RefSeq ORF: 318
• Synonyms: C14orf112; hCOX16; HSPC203
• Locus ID: 51241
• UniProt ID: Q9P0S2
• Cytogenetics: 14q24.2
• Summary: Required for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase (PubMed:29355485, PubMed:29381136). Promotes the insertion of copper into the active site of cytochrome c oxidase subunit II (MT-CO2/COX2) (PubMed:29355485, PubMed:29381136). Interacts specifically with newly synthesized MT-CO2/COX and its copper center-forming metallochaperones SCO1, SCO2 and COA6 (PubMed:29381136). Probably facilitates MT-CO2/COX2 association with the MITRAC assembly intermediate containing MT-CO1/COX1, thereby participating in merging the MT-CO1/COX1 and MT-CO2/COX2 assembly lines (PubMed:29381136).[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein, Transmembrane