OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COX16 (NM_016468) Human Mass Spec Standard

Be the first to review this product
SKU
PH300099
COX16 MS Standard C13 and N15-labeled recombinant protein (NP_057552)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA324145 Anti-COX16 Rabbit Polyclonal Antibody
100 ul
$305.00
LY413968 Transient overexpression lysate of COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX16) (as WB positive control) 100 ug
$436.00

Other products for "COX16 or NM_016468"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200099
Predicted MW 12.3 kDa
Protein Sequence
Protein Sequence
>RC200099 protein sequence
Red=Cloning site Green=Tags(s)

MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKI
KDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057552
RefSeq Size 1724
RefSeq ORF 318
Synonyms C14orf112; hCOX16; HSPC203
Locus ID 51241
UniProt ID Q9P0S2
Cytogenetics 14q24.2
Summary Required for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase (PubMed:29355485, PubMed:29381136). Promotes the insertion of copper into the active site of cytochrome c oxidase subunit II (MT-CO2/COX2) (PubMed:29355485, PubMed:29381136). Interacts specifically with newly synthesized MT-CO2/COX and its copper center-forming metallochaperones SCO1, SCO2 and COA6 (PubMed:29381136). Probably facilitates MT-CO2/COX2 association with the MITRAC assembly intermediate containing MT-CO1/COX1, thereby participating in merging the MT-CO1/COX1 and MT-CO2/COX2 assembly lines (PubMed:29381136).UniProtKB/Swiss-Prot Function
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COX16" proteins (3)
SKU Description Size Price
LC413968 Lyophilized COX16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413968 Transient overexpression lysate of COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX16) (as WB positive control) 100 ug
$436.00
TP300099 Recombinant protein of human COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX16), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products