OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

METTL11A (NTMT1) (NM_014064) Human Mass Spec Standard

Be the first to review this product
SKU
PH300055
METTL11A MS Standard C13 and N15-labeled recombinant protein (NP_054783)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350168 Rabbit Polyclonal Anti-NTMT1 Antibody
100 ul
$205.00
LY415489 Transient overexpression lysate of methyltransferase like 11A (METTL11A) (as WB positive control) 100 ug
$436.00

Other products for "METTL11A or NM_014064"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200055
Predicted MW 25.4 kDa
Protein Sequence
Protein Sequence
>RC200055 protein sequence
Red=Cloning site Green=Tags(s)

MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGA
GIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGH
LTDQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENL
PDEIYHVYSFALR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054783
RefSeq Size 1536
RefSeq ORF 669
Synonyms AD-003; C9orf32; HOMT1A; METTL11A; NRMT; NRMT1; NTM1A
Locus ID 28989
UniProt ID Q9BV86
Cytogenetics 9q34.11
Summary The METTL11A gene encodes an N-terminal methyltransferase for the RAN (MIM 601179) guanine nucleotide exchange factor regulator of chromosome condensation 1 (RCC1; MIM 179710). METTL11A enzyme alpha-N-methylates other protein targets such as SET (MIM 600960) and RB (MIM 180200).supplied by OMIM, Nov 2010
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "METTL11A" proteins (3)
SKU Description Size Price
LC415489 Lyophilized NTMT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415489 Transient overexpression lysate of methyltransferase like 11A (METTL11A) (as WB positive control) 100 ug
$436.00
TP300055 Recombinant protein of human methyltransferase like 11A (METTL11A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products