OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

POLDIP2 (NM_015584) Human Mass Spec Standard

Be the first to review this product
SKU
PH300053
POLDIP2 MS Standard C13 and N15-labeled recombinant protein (NP_056399)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA385002 POLDIP2 Rabbit monoclonal Antibody
100 ul
$380.00
LY402448 Transient overexpression lysate of polymerase (DNA-directed), delta interacting protein 2 (POLDIP2) (as WB positive control) 100 ug
$436.00

Other products for "POLDIP2 or NM_015584"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200053
Predicted MW 42 kDa
Protein Sequence
Protein Sequence
>RC200053 protein sequence
Red=Cloning site Green=Tags(s)

MAACTARRALAVGSRWWSRSLTGARWPRPLCAAAGAGAFSPASTTTTRRHLSSRNRPEGKVLETVGVFEV
PKQNGKYETGQLFLHSIFGYRGVVLFPWQARLYDRDVASAAPEKAENPAGHGSKEVKGKTHTYYQVLIDA
RDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDYVSHEDILPYTSTDQVPIQHELFERFLLYDQTKAPP
FVARETLRAWQEKNHPWLELSDVHRETTENIRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLR
ERHWRIFSLSGTLETVRGRGVVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPP
FSLESNKDEKTPPSGLHW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056399
RefSeq Size 2753
RefSeq ORF 1104
Synonyms p38; PDIP38; POLD4
Locus ID 26073
UniProt ID Q9Y2S7
Cytogenetics 17q11.2
Summary This gene encodes a protein that interacts with the DNA polymerase delta p50 subunit, as well as with proliferating cell nuclear antigen. The encoded protein maybe play a role in the ability of the replication fork to bypass DNA lesions. Alternative splicing results in multiple transcript variants. provided by RefSeq, Feb 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "POLDIP2" proteins (3)
SKU Description Size Price
LC402448 Lyophilized POLDIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402448 Transient overexpression lysate of polymerase (DNA-directed), delta interacting protein 2 (POLDIP2) (as WB positive control) 100 ug
$436.00
TP300053 Recombinant protein of human polymerase (DNA-directed), delta interacting protein 2 (POLDIP2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products