OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HEMK1 (NM_016173) Human Mass Spec Standard

Be the first to review this product
SKU
PH300039
HEMK1 MS Standard C13 and N15-labeled recombinant protein (NP_057257)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY414143 Transient overexpression lysate of HemK methyltransferase family member 1 (HEMK1) (as WB positive control) 100 ug
$436.00

Other products for "HEMK1 or NM_016173"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200039
Predicted MW 38.2 kDa
Protein Sequence
Protein Sequence
>RC200039 protein sequence
Red=Cloning site Green=Tags(s)

MELWGRMLWALLSGPGRRGSTRGWAFSSWQPQPPLAGLSSAIELVSHWTGVFEKRGIPEARESSEYIVAH
VLGAKTFQSLRPALWTQPLTSQQLQCIRELSSRRLQRMPVQYILGEWDFQGLSLRMVPPVFIPRPETEEL
VEWVLEEVAQRSHAVGSPGSPLILEVGCGSGAISLSLLSQLPQSRVIAVDKREAAISLTHENAQRLRLQD
RIWIIHLDMTSERSWTHLPWGPMDLIVSNPPYVFHQDMEQLAPEIRSYEDPAALDGGEEGMDIITHILAL
APRLLKDSGSIFLEVDPRHPELVSSWLQSRPDLYLNLVAVRRDFCGRPRFLHIRRSGP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057257
RefSeq Size 5862
RefSeq ORF 1014
Synonyms HEMK; MPRMC; MTQ1
Locus ID 51409
UniProt ID Q9Y5R4
Cytogenetics 3p21.31
Summary N5-glutamine methyltransferase responsible for the methylation of the glutamine residue in the universally conserved GGQ motif of the mitochondrial translation release factor MTRF1L.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Protein Pathways Androgen and estrogen metabolism, Histidine metabolism, Selenoamino acid metabolism, Tyrosine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HEMK1" proteins (3)
SKU Description Size Price
LC414143 Lyophilized HEMK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414143 Transient overexpression lysate of HemK methyltransferase family member 1 (HEMK1) (as WB positive control) 100 ug
$436.00
TP300039 Recombinant protein of human HemK methyltransferase family member 1 (HEMK1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products