MRPS7 (NM_015971) Human Mass Spec Standard

CAT#: PH300031

MRPS7 MS Standard C13 and N15-labeled recombinant protein (NP_057055)

Product Images

Coomassie blue staining of purified MRPS7 protein (Cat# TP300031). The protein was produced from HEK293T cells transfected with MRPS7 cDNA clone (Cat# RC200031) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200031
• Predicted MW: 28.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200031 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVAPAVKVARGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTEEEKYVRELKK
  TQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERN
  PYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLL
  EAFHNQGPVIKRKHDLHKMAEANRALAHYRWW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057055
• RefSeq Size: 1432
• RefSeq ORF: 726
• Synonyms: bMRP27a; COXPD34; MRP-S; MRP-S7; RP-S7; RPMS7; S7mt
• Locus ID: 51081
• UniProt ID: Q9Y2R9, A0A024R8L0
• Cytogenetics: 17q25.1
• Summary: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. In the prokaryotic ribosome, the comparable protein is thought to play an essential role in organizing the 3' domain of the 16 S rRNA in the vicinity of the P- and A-sites. Pseudogenes corresponding to this gene are found on chromosomes 8p and 12p. [provided by RefSeq, Jul 2008]