OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Mouse Anapc11 (NM_025389) AAV Particle

  • AAV ORF®
  • Product Brand Image
Be the first to review this product
SKU
MR200172A1V
AAV ORF Particles, serotype AAV-2, Anapc11 (Myc-DDK-tagged) - Mouse anaphase promoting complex subunit 11 (Anapc11), transcript variant 2, 250ul, >10^13 GC/mL
ORF Plasmid:
DDK
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
  $850.00
4 Weeks*

Frequently Bought Together (3)

CV900001S AAV2 with CMV promoter-driven expression of GFP, >10^13 GC/mL, 50 ul
50 ul
$427.00
CV900018L AAV2 with CMV promoter-driven expression of Myc-DDK, >10^13 GC/mL, 1 x 100 uL
1 x 100 ul
$699.00
PS100089 pAAV-AC-Myc-DDK, AAV vector with C-terminal Myc-DDK tag
10 ug
$880.00

Other products for "Anapc11 or NM_025389"

Specifications
Specifications
Product Data
Tag Myc-DDK
Target Symbol Anapc11
Synonyms 1110011I19Rik; R75218
Vector pAAV-AC-Myc-DDK
Mammalian Cell Selection None
Sequence Data
ORF Nucleotide Sequence
>MR200172 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGTGAAAATTAAATGTTGGAATGGTGTGGCCACTTGGCTCTGGGTAGCCAATGATGAGAACTGCG
GCATCTGCAGGATGGCGTTTAATGGCTGCTGTCCAGACTGTAAGGTGCCTGGTGATGACTGCCCCCTCGT
GTGGGGACAGTGCTCCCACTGCTTCCACATGCACTGCATCCTCAAGTGGCTGAATGCGCAGCAGGTGCAG
CAGCACTGCCCCATGTGTCGCCAGGAGTGGAAGTTCAAAGAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR200172 protein sequence
Red=Cloning site Green=Tags(s)

MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLNAQQVQ
QHCPMCRQEWKFKE

myc-FLAG tag
Species Mouse
Serotype AAV-2
ACCN NM_025389
ORF Size 252 bp
Buffer PBS with 0.001% Pluronic F68
Stability AAV is stable for 1 year when stored at -80°C (long-term storage) or 2-3 weeks when stored at -20°C (short-term storage). Thaw the vial of AAV on ice prior to use and keep it on ice during the experiment. Thawed AAV can be stored at 4°C for 1-2 weeks. Whenever possible, particles should be aliquoted into single use portions to avoid repeated freeze/thaw cycles. Please aliquot at least 10ul per tube and use low protein binding tubes to avoid loss of virus.
Shipping Dry Ice
Reference Data
RefSeq NM_025389.4, NP_079665.1
RefSeq Size 3229 bp
RefSeq ORF 255 bp
Locus ID 66156
UniProt ID Q9CPX9
Cytogenetics 11 E2
MW 9.8 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products