OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UGCGL2 (UGGT2) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA346804
Rabbit Polyclonal Anti-UGCGL2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "UGCGL2 or NM_020121" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-UGCGL2 antibody: synthetic peptide directed towards the N terminal of human UGCGL2. Synthetic peptide located within the following region: KHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 172 kDa
Gene Name UDP-glucose glycoprotein glucosyltransferase 2
Database Link
Background UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER. supplied by OMIM, Oct 2009. ##Evidence-Data-START## Transcript exon combination :: AF227906.2, BC125233.1 ECO:0000332 RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 ECO:0000350 ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Synonyms HUGT2; UGCGL2; UGT2
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Dog: 92%; Rat: 86%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products