OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRM11 (TRMT11) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA346691
Rabbit Polyclonal Anti-TRMT11 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY422163 Transient overexpression lysate of tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11) (as WB positive control) 100 ug
$436.00
TP308923 Recombinant protein of human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11), 20 µg
20 ug
$737.00

View other "TRM11 or NM_001031712" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TRMT11 antibody: synthetic peptide directed towards the N terminal of human TRMT11. Synthetic peptide located within the following region: IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 53 kDa
Gene Name tRNA methyltransferase 11 homolog
Database Link
Background Catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.
Synonyms C6orf75; MDS024; TRM11; TRMT11-1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Categories Intracellular Proteins
Protein Pathways Androgen and estrogen metabolism, Histidine metabolism, Selenoamino acid metabolism, Tyrosine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products