WDR58 (THOC6) Rabbit Polyclonal Antibody

SKU TA346641

Rabbit Polyclonal Anti-THOC6 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-THOC6 antibody: synthetic peptide directed towards the middle region of human THOC6. Synthetic peptide located within the following region: AGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: THO complex 6
• Database Link:
  NP_077315
  Q86W42
• Background: THOC6 belongs to the WD repeat THOC6 family.It contains 7 WD repeats. The function of the THOC6 protein remains unknown.
• Synonyms: BBIS; fSAP35; WDR58
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data