HBZ Rabbit Polyclonal Antibody

CAT#: TA346403

Rabbit Polyclonal Anti-HBZ Antibody

Product Images

WB Suggested Anti-HBZ Antibody Titration: 1.25 ug/ml; Positive Control: K562 cell lysate; HBZ is supported by BioGPS gene expression data to be expressed in K562

• 

  Rabbit Anti-HBZ Antibody; Paraffin Embedded Tissue: Human Liver; Cellular Data: Hemopoietic; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HBZ antibody: synthetic peptide directed towards the N terminal of human HBZ. Synthetic peptide located within the following region: ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: hemoglobin subunit zeta
• Database Link:
  NP_005323
  Entrez Gene 3050 Human
  UniProt ID P02008
• Background: Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'.Zeta-globin (HBZ ) is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that involves 4 functional genes and 3 nonfunctional pseudogenes. The order of genes is: 5'-zeta -- pseudozeta -- pseudoalpha2 -- pseudoalpha1 -- alpha2 -- alph1 -- theta1-3'.
• Synonyms: HBZ-T1; HBZ1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Goat: 93%; Bovine: 93%; Rabbit: 92%; Horse: 86%; Mouse: 85%

Reference Data

• Protein Families: Embryonic stem cells, ES Cell Differentiation/IPS