CCBL2 (KYAT3) Rabbit Polyclonal Antibody

CAT#: TA345720

Reviews ()
Write a review

Rabbit Polyclonal Anti-RP11-82K18.3 Antibody



Get 29% off any Over-Expression Cell Lysate, a validated WB control, with any Ab purchase. Use code “OEL29“. View details.

USD 300.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RP11-82K18.3 antibody: synthetic peptide directed towards the N terminal of human RP11-82K18.3. Synthetic peptide located within the following region: SGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 46 kDa
Gene Name kynurenine aminotransferase 3
Background RP11-82K18.3 is an aminotransferase that transaminates kynurenine to form kynurenic acid. Kynurenic acid is a metabolite of tryptophan.
Synonyms CCBL2; KAT3; KATIII
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 92%; Rat: 91%; Zebrafish: 91%; Rabbit: 86%; Guinea pig: 85%
Reference Data
Other products for "KYAT3"
Frequently bought together (3)
Recombinant protein of human cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 2
    • 20 ug

USD 748.00


Transient overexpression lysate of cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 2
    • 100 ug

USD 550.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 169.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies