TRIOBP Rabbit Polyclonal Antibody

CAT#: TA345504

Rabbit Polyclonal Anti-TRIOBP Antibody

Product Images

WB Suggested Anti-TRIOBP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIOBP antibody: synthetic peptide directed towards the middle region of human TRIOBP. Synthetic peptide located within the following region: VQALRAQLEAWRLQGEAPQSALRSQEDGHIPPGYISQLVGVITVPVLQTR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: TRIO and F-actin binding protein
• Database Link:
  NP_619538
  Entrez Gene 11078 Human
  UniProt ID Q9H2D6
• Background: TRIOBP is a protein with an N-terminal pleckstrin homology domain and a C-terminal coiled-coil region. The protein interacts with trio, which is involved with neural tissue development and controlling actin cytoskeleton organization, cell motility and cel
• Synonyms: DFNB28; dJ37E16.4; HRIHFB2122; TAP68; TARA
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 92%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%