OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TUT1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA345368
Rabbit Polyclonal Anti-TUT1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY411544 Transient overexpression lysate of terminal uridylyl transferase 1, U6 snRNA-specific (TUT1) (as WB positive control) 100 ug
$436.00
TP311126 Purified recombinant protein of Homo sapiens terminal uridylyl transferase 1, U6 snRNA-specific (TUT1), 20 µg
20 ug
$737.00

View other "TUT1 or NM_022830" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TUT1 antibody: synthetic peptide directed towards the middle region of human TUT1. Synthetic peptide located within the following region: EGAGGGAGTRAGWLATEAQVTQELKGLSGGEERPETEPLLSFVASVSPAD
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 94 kDa
Gene Name terminal uridylyl transferase 1, U6 snRNA-specific
Database Link
Background TUT1 is a nucleotidyl transferase that functions as both a terminal uridylyltransferase and a nuclear poly(A) polymerase. TUT1 specifically adds and removes nucleotides from the 3' end of small nuclear RNAs and select mRNAs and may function in controlling gene expression and cell proliferation. TUT1 specifically catalyzes uridylylation of U6 snRNA (RNU6; MIM 180692) and is essential for cell proliferation (Trippe et al., 2006 PubMed 16790842). supplied by OMIM
Synonyms PAPD2; RBM21; STARPAP; TUTase; URLC6
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products