OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Zinc finger MIZ domain containing protein 1 (ZMIZ1) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA345286
Rabbit Polyclonal Anti-ZMIZ1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY402770 Transient overexpression lysate of zinc finger, MIZ-type containing 1 (ZMIZ1) (as WB positive control) 100 ug
$665.00

View other "Zinc finger MIZ domain containing protein 1 or NM_020338" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human, Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZMIZ1 antibody: synthetic peptide directed towards the N terminal of human ZMIZ1. Synthetic peptide located within the following region: MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 115 kDa
Gene Name zinc finger MIZ-type containing 1
Database Link
Background ZMIZ1 increases ligand-dependent transcriptional activity of AR and promotes AR sumoylation. The stimulation of AR activity is dependent upon sumoylation.
Synonyms hZIMP10; MIZ; RAI17; TRAFIP10; ZIMP10
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 82%
Reference Data
Protein Categories Growth Factors, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products