OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BRP44L (MPC1) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA345066
Rabbit Polyclonal Anti-MPC1 Antibody - N-terminal region
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY414188 Transient overexpression lysate of brain protein 44-like (BRP44L) (as WB positive control) 100 ug
$436.00
TP301461 Recombinant protein of human brain protein 44-like (BRP44L), 20 µg
20 ug
$867.00

View other "BRP44L or NM_016098" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Rat
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Mpc1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Mpc1. Synthetic peptide located within the following region: GALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIIS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 11 kDa
Gene Name mitochondrial pyruvate carrier 1
Database Link
Background may be involved in apoptosis of neuronal cells RGD, Feb 2006. ##Evidence-Data-START## Transcript exon combination :: AF304429.1, BC097287.1 ECO:0000332 RNAseq introns :: single sample supports all introns SRS388403, SRS388410 ECO:0000348 ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: inferred from homology ##RefSeq-Attributes-END##
Synonyms BRP44L; CGI-129; dJ68L15.3; MPYCD
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Yeast: 90%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products