C12orf4 Rabbit Polyclonal Antibody

SKU TA344789

Rabbit Polyclonal Anti-C12orf4 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C12orf4 antibody: synthetic peptide directed towards the N terminal of human C12orf4. Synthetic peptide located within the following region: EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 64 kDa
• Gene Name: chromosome 12 open reading frame 4
• Database Link:
  NP_065107
  Q9NQ89
• Background: The function of this protein remains unknown.
• Synonyms: FLJ21158; FLJ23899
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Zebrafish: 93%; Guinea pig: 93%

Reference Data