OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRUNE (PRUNE1) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA344725
Rabbit Polyclonal Anti-PRUNE Antibody - C-terminal region
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY402855 Transient overexpression lysate of prune homolog (Drosophila) (PRUNE) (as WB positive control) 100 ug
$436.00

View other "PRUNE or NM_021222" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PRUNE antibody is: synthetic peptide directed towards the C-terminal region of Human PRUNE. Synthetic peptide located within the following region: NSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQIS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 26 kDa
Gene Name prune exopolyphosphatase
Database Link
Background The function of this protein remains unknown.
Synonyms DRES-17; DRES17; HTCD37
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data
Protein Categories Intracellular Proteins
Protein Pathways Purine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

NMIHBA results from hypomorphic PRUNE1 variants that lack short-chain exopolyphosphatase activity
Nistala, Dronzek, Gonzaga-Jauregui et al
Hum Mol Genet (2020)
Cited by 19
AI Summary: OriGene’s anti-PRUNE1 antibody (TA344725) was used for immunoblotting to analyze PRUNE1 protein levels in overexpressing HEK293 cells and human fibroblasts in this study.
Snippet: PRUNE1 levels in overexpressing HEK293 and in human fibroblasts were analyzed by immunoblotting using anti-PRUNE1 (Origene;TA344725) and/or anti-HA (Abcam;18181) antibodies at 1:1000 dilution, using GAPDH (CST;3683S) as a loading control
WB
Functional modeling of NMIHBA-causing PRUNE1 variants reveals a requirement for its exopolyphosphatase activity
Nistala, Dronzek, Gonzaga-Jauregui et al
bioRxiv (2020)
Cited by 1
Snippet: assay. PRUNE1 levels in overexpressing HEK293 and in human fibroblasts were analyzed by immunoblotting using anti-PRUNE1 (Origene;TA344725) and/or anti-HA (Abcam;18181) antibodies at 1:1000 dilution, using GAPDH (CST;3683S) as a loading control
WB
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products