OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DDAH2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA344265
Rabbit Polyclonal Anti-DDAH2 Antibody - N-terminal region
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY415561 Transient overexpression lysate of dimethylarginine dimethylaminohydrolase 2 (DDAH2) (as WB positive control) 100 ug
$436.00

View other "DDAH2 or NM_013974" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human, Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DDAH2 antibody: synthetic peptide directed towards the N terminal of human DDAH2. Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 31 kDa
Gene Name dimethylarginine dimethylaminohydrolase 2
Database Link
Background DDAH2 hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. DDAH2 has therefore a role in nitric oxide generation.This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms DDAH; DDAHII; G6a; HEL-S-277; NG30
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Rabbit: 79%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

The iridoid loganic acid and anthocyanins from the cornelian cherry (Cornus mas L.) fruit increase the plasma l-arginine/ADMA ratio and decrease levels of ADMA in rabbits fed a high-cholesterol diet
Sozański, Kucharska, Wiśniewski et al
Phytomedicine (2019) 52, 1-11 DOI: 10.1016/j.phymed.2018.09.175
Cited by 27
AI Summary: In this study, OriGene’s rabbit anti-DDAH1 (Cat# TA326527) and rabbit anti-DDAH2 (Cat# TA326528) antibodies were used for western blot analysis to assess hepatic DDAH isoform expression, helping to evaluate the effects of cornelian cherry constituents on the l-arginine-ADMA pathway in rabbits.
The iridoid loganic acid and anthocyanins from the cornelian cherry (Cornus mas L.) fruit increase the plasma L-arginine/ADMA ratio and decrease levels of ADMA in rabbits fed a high-cholesterol diet
Sozański, Kucharska, Wiśniewski et al
Phytomedicine (2018)
AI Summary: In this study, OriGene's primary antibodies DDAH1 (TA334438) and DDAH2 (TA344265) were used to detect and measure the expression of DDAH1 and DDAH2 proteins, helping to assess the effects of loganic acid and anthocyanins on these targets in rabbits fed a high-cholesterol diet.
Snippet: After the transfer, the membrane was blocked with 1% casein in TBS at 4°C, overnight, and then incubated with 1 µg/ml of primary antibody, DDAH1 (Origene TA334438), DDAH2 (Origene, TA344265) and beta-actin (Santa Cruz Biotechnology, AC-15) at room
WB
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products