OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WRCH1 (RHOU) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA344077
Rabbit Polyclonal Anti-RHOU Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY412011 Transient overexpression lysate of ras homolog gene family, member U (RHOU) (as WB positive control) 100 ug
$436.00

View other "WRCH1 or NM_021205" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RHOU antibody: synthetic peptide directed towards the C terminal of human RHOU. Synthetic peptide located within the following region: LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 28 kDa
Gene Name ras homolog family member U
Database Link
Background RHOU is a member of the Rho family of GTPases. It can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.
Synonyms ARHU; CDC42L1; G28K; hG28K; WRCH1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Rat: 79%; Guinea pig: 79%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

An RNAi screen unravels the complexities of Rho GTPase networks in skin morphogenesis
Laurin, Gomez, Levorse et al
Elife (2019) 8 DOI: 10.7554/eLife.50226
AI Summary: OriGene products, specifically the RHOU shRNA lentiviral particles, were used in this study to achieve targeted RNAi-mediated knockdown of RHOU, enabling the authors to investigate its role in cytoskeletal remodeling and skin morphogenesis.
Snippet: argely unexplored. Conventional genetic analyses have provided valuable insights into RAC1, RHOA and CDC42 Rho GTPases in skin. Postnatal roles for these Rho GTPases include stem cell maintenance, tumorigenesis, migration, wound-repair and immune-epithelial crosstalk (Benitah et al., 2005;Tscharntke et al., 2007;Wang et al., 2010;Winge et al., 2016;García-Mariscal et al., 2018). In addition,
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products