BRD4 Rabbit Polyclonal Antibody

CAT#: TA343731

Rabbit Polyclonal Anti-BRD4 Antibody

Product Images

WB Suggested Anti-BRD4 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Thymus

• 

  Sample Type: HeLa; Primary Antibody Dilution: 4 ug/ml; Secondary Antibody: Anti-rabbit Alexa 546; Secondary Antibody Dilution: 2 ug/ml; Gene Name: BRD4

• 

  Chromatin Immunoprecipitation (ChIP) Using BRD4 antibody - C-terminal region and HCT116 Cells

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF, ChIP
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BRD4 antibody: synthetic peptide directed towards the C terminal of human BRD4. Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 80 kDa
• Gene Name: bromodomain containing 4
• Database Link:
  NP_055114
  Entrez Gene 23476 Human
  UniProt ID O60885
• Background: BRD4 is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting.The protein encoded by this gene is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting. This gene has been implicated as the chromosome 19 target of translocation t(15;19)(q13;p13.1), which defines an upper respiratory tract carcinoma in young people. Two alternatively spliced transcript variants have been described.
• Synonyms: CAP; HUNK1; HUNKI; MCAP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Protein Kinase