HEY2 Rabbit Polyclonal Antibody

CAT#: TA343694

Rabbit Polyclonal Anti-HEY2 Antibody

Product Images

WB Suggested Anti-HEY2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HEY2 antibody: synthetic peptide directed towards the middle region of human HEY2. Synthetic peptide located within the following region: PMLPPNAAAAVAAATAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: hes related family bHLH transcription factor with YRPW motif 2
• Database Link:
  NP_036391
  Entrez Gene 23493 Human
  UniProt ID Q9UBP5
• Background: HEY2 is a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. HEY2 forms homo- or hetero-dimers that localize to the nucleus and interact with a histone deacetylase complex to repres
• Synonyms: bHLHb32; CHF1; GRIDLOCK; GRL; HERP1; HESR2; HRT2
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Dog: 90%; Rabbit: 90%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors