HEY2 Rabbit Polyclonal Antibody

CAT#: TA343694

Reviews ()
Write a review

Rabbit Polyclonal Anti-HEY2 Antibody



USD 396.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HEY2 antibody: synthetic peptide directed towards the middle region of human HEY2. Synthetic peptide located within the following region: PMLPPNAAAAVAAATAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name hes related family bHLH transcription factor with YRPW motif 2
Background HEY2 is a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. HEY2 forms homo- or hetero-dimers that localize to the nucleus and interact with a histone deacetylase complex to repres
Synonyms bHLHb32; CHF1; GRIDLOCK; GRL; HERP1; HESR2; HRT2
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Dog: 90%; Rabbit: 90%; Zebrafish: 86%
Reference Data
Protein Families Druggable Genome, Transcription Factors
Other products for "HEY2"
Frequently bought together (3)
Recombinant protein of human hairy/enhancer-of-split related with YRPW motif 2 (HEY2)
    • 20 ug

USD 823.00


Transient overexpression lysate of hairy/enhancer-of-split related with YRPW motif 2 (HEY2)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 186.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies