HOXB7 Rabbit Polyclonal Antibody

CAT#: TA343468

Rabbit Polyclonal Anti-HOXB7 Antibody


 Product Datasheet for 'TA343468'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-HOXB7 antibody: synthetic peptide directed towards the C terminal of human HOXB7. Synthetic peptide located within the following region: RYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRA
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 24kDa
Gene Name homeobox B7
Background HOXB7 is a member of the Antp homeobox family and is a protein with a homeobox DNA-binding domain. The nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.
Synonyms HHO.C1|HOX2|HOX2C|Hox-2.3
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rabbit: 93%
Reference Data
Protein Families Transcription Factors
Other products for "HOXB7"
Frequently bought together (2)
Transient overexpression lysate of homeobox B7 (HOXB7)
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones