EMR3 (ADGRE3) Rabbit Polyclonal Antibody

SKU TA342888

Rabbit Polyclonal Anti-EMR3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EMR3 antibody is: synthetic peptide directed towards the C-terminal region of Human EMR3. Synthetic peptide located within the following region: SQQVQKQYQKWFREIVKSKSESETYTLSSKMGPDSKPSEGDVFPGQVKRK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: adhesion G protein-coupled receptor E3
• Database Link:
  NP_115960
  Q9BY15
• Background: The function of this protein remains unknown.
• Synonyms: EMR3
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane