ZNF117 Rabbit Polyclonal Antibody

CAT#: TA342454

Rabbit Polyclonal Anti-ZNF117 Antibody

Product Images

WB Suggested Anti-ZNF117 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF117 antibody: synthetic peptide directed towards the middle region of human ZNF117. Synthetic peptide located within the following region: EIPYKCEKCVRAFNQASKLTEHKLIHTGEKRYECEECGKAFNRSSKLTEH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: zinc finger protein 117
• Database Link:
  NP_056936
  Entrez Gene 51351 Human
  UniProt ID Q03924
• Background: May be involved in transcriptional regulation.
• Synonyms: H-plk; HPF9
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 91%