SPOPL Rabbit Polyclonal Antibody

SKU TA342109

Rabbit Polyclonal Anti-SPOPL Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPOPL antibody: synthetic peptide directed towards the N terminal of human SPOPL. Synthetic peptide located within the following region: KGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQRAY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: speckle type BTB/POZ protein like
• Database Link:
  NP_001001664
  Q6IQ16
• Background: SPOPL belongs toThe Tdpoz family. It contains 1 BTB (POZ) domain and 1 MATH domain. In complex with a cullin, SPOPL may act in ubiquitination and proteasomal degradation processes.
• Synonyms: BTBD33
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data